| Protein or peptide name: | ELA |
| Chromosome: | 1 |
| Protein or peptide start site: | NA |
| Protein or peptide end site: | NA |
| ncRNA start site: | 19667947 |
| ncRNA end site: | 19673896 |
| Genome Browser: | NA |
| Protein or peptide sequence: | QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP |
| Protein or peptide length: | 32aa |
| ncRNA type: | ncRNA |
| ncRNA name: | ELABELA (ELA) |
| Entrez ID: | 100536023 |
| Experimental species: | Danio rerio (zebrafish) |
| Experimental techniques: | Immunofluorescence/western blotting/ RT-PCR/qPCR |
| Experimental sample (cell line and/or tissue): | Naive ectodermal cells of the embryo |
| Description: | We report here the discovery and characterization of a gene, ELABELA (ELA), encoding a conserved hormone of 32 amino acids. |
| Subcellular location: | NA |
| Function: | Loss of Ela causes embryos to develop with a rudimentary heart or no heart at all, surprisingly phenocopying the loss of the apelin receptor (aplnr), which we show serves as Ela cognate G protein-coupled receptor. |
| Title of paper: | ELABELA: A Hormone Essential for Heart Development Signals via the Apelin Receptor |
| PMID: | 24316148 |
| Year of publication: | 2013 |
